PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013606766.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ZF-HD
Protein Properties Length: 271aa    MW: 31029.6 Da    PI: 9.7734
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013606766.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.62.2e-3182137258
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     ++v Y+eC++NhAas Ggh+vDGCgEfm+s geegta++l CaAC+CHR+FHR+e +
  XP_013606766.1  82 RRVSYRECQRNHAASSGGHVVDGCGEFMSS-GEEGTAESLLCAACDCHRSFHRKEID 137
                     5799*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-3470146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.1E-2984136IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.66386135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.6E-2986136IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466897.26E-18200268IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28201269IPR009057Homeodomain-like
TIGRFAMsTIGR015652.9E-28207264IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEVREKKDDK IEMERRRRQS SPNQNIQDHR RPPYTYSQTA DKEKPTTKRN GSDPDPDLDI  60
NPTSIAPAPR SYARPQTTSP TRRVSYRECQ RNHAASSGGH VVDGCGEFMS SGEEGTAESL  120
LCAACDCHRS FHRKEIDGMF VVKFNSFGHS QRPLVNRHVS PIMMSFGGGG GGGGGGRDPA  180
ESSTEDLNRF HQALSGNGVD QFQYHPKKRF RTKFNQEQKE RMFEFAEKIG WRMNKTEDEE  240
VNRFCREINV KRQVFKVWMH NNKQAAKKKD M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-192082651875ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325500.0AC232550.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH011J16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013606766.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-150ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A0D3E3A90.0A0A0D3E3A9_BRAOL; Uncharacterized protein
STRINGBra037224.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-147homeobox protein 24